General Information

  • ID:  hor000275
  • Uniprot ID:  P07492(24-50)
  • Protein name:  Gastrin-releasing peptide
  • Gene name:  GRP
  • Organism:  Homo sapiens (Human)
  • Family:  Bombesin/neuromedin-B/ranatensin family
  • Source:  Human
  • Expression:  NA
  • Disease:  Diseases associated with GRP include Duodenal Ulcer and Diffuse Pulmonary Fibrosis.
  • Comments:  NA
  • Taxonomy:  Homo (genus), Homininae (subfamily), Hominidae (family), Hominoidea (superfamily), Catarrhini (parvorder), Simiiformes (infraorder), Haplorrhini (suborder), Primates (order), Euarchontoglires (superorder), Boreoeutheria, Eutheria, Theria, Mammalia (class), Amniota, Tetrapoda, Dipnotetrapodomorpha, Sarcopterygii (superclass), Euteleostomi, Teleostomi, Gnathostomata, Vertebrata, Craniata (subphylum), Chordata (phylum), Deuterostomia, Bilateria, Eumetazoa, Metazoa (kingdom), Opisthokonta, Eukaryota (superkingdom), cellular organisms
  • GO MF:  GO:0005102 signaling receptor binding; GO:0005184 neuropeptide hormone activity; GO:0005515 protein binding
  • GO BP:  GO:0001503 ossification; GO:0007165 signal transduction; GO:0007218 neuropeptide signaling pathway; GO:0010468 regulation of gene expression; GO:0035176 social behavior; GO:0036343 psychomotor behavior; GO:0043207 response to external biotic stimulus; GO:0043303 mast cell degranulation; GO:0090277 positive regulation of peptide hormone secretion; GO:1900738 positive regulation of phospholipase C-activating G protein-coupled receptor signaling pathway; GO:1903817 negative regulation of voltage-gated potassium channel activity; GO:1903942 positive regulation of respiratory gaseous exchange; GO:1904384 cellular response to sodium phosphate; GO:1905151 negative regulation of voltage-gated sodium channel activity; GO:1905461 positive regulation of vascular associated smooth muscle cell apoptotic process; GO:2000987 positive regulation of behavioral fear response
  • GO CC:  GO:0005576 extracellular region; GO:0005615 extracellular space; GO:0031410 cytoplasmic vesicle; GO:0034774 secretory granule lumen; GO:0042995 cell projection; GO:0043005 neuron projection; GO:0098992 neuronal dense core vesicle

Sequence Information

  • Sequence:  VPLPAGGGTVLTKMYPRGNHWAVGHLM
  • Length:  27(24-50)
  • Propeptide:  MRGRELPLVLLALVLCLAPRGRAVPLPAGGGTVLTKMYPRGNHWAVGHLMGKKSTGESSSVSERGSLKQQLREYIRWEEAARNLLGLIEAKENRNHQPPQPKALGNQQPSWDSEDSSNFKDVGSKGKVGRLSAPGSQREGRNPQLNQQ
  • Signal peptide:  MRGRELPLVLLALVLCLAPRGRA
  • Modification:  T27 Methionine amide
  • Glycosylation:  NA
  • Mutagenesis:  NA

Activity

  • Function:  Play a transient and non-critical role in intestinal development;triggers the growth of HepG2 cells;Stimulates the release of gastrin and other gastrointestinal hormones
  • Mechanism:  GRP triggers the growth of HepG2 cells through blocking the ER stress-mediated pathway.
  • Cross BBB:  NA
  • Target:  GRPR
  • Target Unid:  P30550
  • IC50: NA
  • EC50: NA
  • ED50: NA
  • kd: NA
  • Half life: 2.8???.4 min minute; /168 seconds ( PubMed ID: 6736205 )

Structure

  • Disulfide bond:  NA
  • Structure ID:  AF-P10092-F1(AlphaFold_DB_ID)
  • Structure: (PDB_ID-from https://www.rcsb.org/; AlphaFold_DB_ID-from https://alphafold.ebi.ac.uk/; hordbxxxxxx_AF2.pdb was predicted structure by AlphaFold2; hordbxxxxxx_ESM.pdb was predicted structure by ESMFold)
  •    AF-P10092-F1.pdbhor000275_AF2.pdbhor000275_ESM.pdb

    Please select some value
    Remove Label
    Add Label

    Please select some value
    Remove Label
    Add Label

    Please select some value
    Remove Label
    Add Label

Physical Information

Mass: 332434 Formula: C130H203N37O32S2
Absent amino acids: CDEFIQS Common amino acids: G
pI: 10.45 Basic residues: 4
Polar residues: 9 Hydrophobic residues: 9
Hydrophobicity: 10 Boman Index: 52
Half-Life: 100 hour Half-Life Yeast: >20 hour
Half-Life E.Coli: >10 hour Aliphatic Index 82.96
Instability Index: 4358.15 Extinction Coefficient cystines: 6990
Absorbance 280nm: 268.85

Literature

  • PubMed ID:  3211139
  • Title:  Posttranslational Processing of Endogenous and of Baculovirus-Expressed Human Gastrin-Releasing Peptide Precursor.
  • PubMed ID:  11960700
  • Title:  Contribution of Gastrin-Releasing Peptide and Its Receptor to Villus Development in the Murine and Human Gastrointestinal Tract
  • PubMed ID:  6736205
  • Title: